OR1I1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84201

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR1I1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1I1. Peptide sequence: GKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for OR1I1 Antibody - BSA Free

Western Blot: OR1I1 Antibody [NBP2-84201]

Western Blot: OR1I1 Antibody [NBP2-84201]

Western Blot: OR1I1 Antibody [NBP2-84201] - WB Suggested Anti-OR1I1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Stomach

Applications for OR1I1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR1I1

OR1I1 is an olfactory receptor that interacts with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. Members of a large family of G protein coupled receptors 7 transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein mediated transduction of odorant signals.

Alternate Names

Olfactory receptor 19-20, olfactory receptor 1I1, olfactory receptor, family 1, subfamily I, member 1, OR19-20OR1I1P, OR1I1Q

Gene Symbol

OR1I1

Additional OR1I1 Products

Product Documents for OR1I1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR1I1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR1I1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR1I1 Antibody - BSA Free and earn rewards!

Have you used OR1I1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies