ORP8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59815

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ORP8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the middle region of OSBPL8. Peptide sequence YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ORP8 Antibody - BSA Free

Western Blot: ORP8 Antibody [NBP1-59815]

Western Blot: ORP8 Antibody [NBP1-59815]

Western Blot: ORP8 Antibody [NBP1-59815] - HT1080, Antibody Dilution: 1.0 ug/ml OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.
Western Blot: ORP8 Antibody [NBP1-59815]

Western Blot: ORP8 Antibody [NBP1-59815]

Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: ORP8 Antibody [NBP1-59815]

Western Blot: ORP8 Antibody [NBP1-59815]

Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3, Antibody Dilution: 1.0 ug/ml OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3.

Applications for ORP8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORP8

OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.

Alternate Names

MGC126578, MGC133203, MST120, MSTP120, ORP-8, ORP8KIAA1451, OSBP10DKFZp686A11164, OSBP-related protein 8, oxysterol binding protein-like 8, oxysterol-binding protein-related protein 8

Gene Symbol

OSBPL8

UniProt

Q68D75 (Human)

Additional ORP8 Products

Product Documents for ORP8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ORP8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ORP8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ORP8 Antibody - BSA Free and earn rewards!

Have you used ORP8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies