Recombinant Mouse OX40 Ligand/TNFSF4 Protein

Novus Biologicals | Catalog # NBP2-26577

Novus Biologicals
Loading...

Key Product Details

Applications

Functional Assay, SDS-PAGE
Loading...

Product Specifications

Description

A recombinant protein corresponding to TNFSF4.

Amino Acid Sequence:
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKSGRQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL Mouse Ig-Fc amino acid sequence, followed by linker (SGR) in bold and Extracellular mouse OX40L amino acid sequence is underlined

Purity

Protein A purified

Endotoxin Level

Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.

Predicted Molecular Mass

43.54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

In vitro proliferation assay, in vivo assays.This protein was measured by its ability to co-stimulate IL-2 secretion in the presence of anti-mCD3, and agonist antibody OX86.

Applications

Functional (reported in scientific literature (PMID 24633226))
In vitro assay (reported in scientific literature (PMID 24633226))

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Mouse OX40 Ligand/TNFSF4 Protein

In vitro assay: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]

In vitro assay: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]

In vitro assay: TNFSF4 Protein [NBP2-26577] - Demonstration in vitro of the potency of Fc-OX40L in comparison to an agonist antibody OX86, with anti-CD3 alone serving as a negative control for co-stimulation.
SDS-PAGE: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]

SDS-PAGE: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]

SDS-Page: TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-20% reducing SDS-PAGE.
SDS-PAGE: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]

SDS-PAGE: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]

SDS-Page: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-15% reducing SDS-PAGE.

Formulation, Preparation, and Storage

NBP2-26577
Formulation Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized.
Preservative No Preservative
Concentration 2 mg/ml
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: OX40 Ligand/TNFSF4

OX40 (CD134) and its natural ligand OX40L (CD134L) belong to the tumor necrosis factor superfamily. OX40L is primarily expressed on antigen presenting cells including activated B-cells, dendritic cells, and macrophages. OX40L has been shown to be expressed on activated endothelial cells and CD4+ T-cells during antigen stimulation. OX-40 and OX-40L interactions are crucial for the generation and survival of memory CD4+ T-cells. These interactions may stimulate effector and memory CD4+ and CD8+ T-cells and suppress CD4+/CD25+ Tregs and may have a role in enhanced immune response.

Alternate Names

CD252, gp34, TNFSF4

Gene Symbol

TNFSF4

Additional OX40 Ligand/TNFSF4 Products

Product Documents for Recombinant Mouse OX40 Ligand/TNFSF4 Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Mouse OX40 Ligand/TNFSF4 Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Mouse OX40 Ligand/TNFSF4 Protein

Customer Reviews for Recombinant Mouse OX40 Ligand/TNFSF4 Protein

There are currently no reviews for this product. Be the first to review Recombinant Mouse OX40 Ligand/TNFSF4 Protein and earn rewards!

Have you used Recombinant Mouse OX40 Ligand/TNFSF4 Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Mouse OX40 Ligand/TNFSF4 Protein

Showing  1 - 1 的 1 FAQ Showing All
  • Q: Could you let me know the expression cell of this recombinant protein?

    A: The actual cell line(s) that was used is considered a proprietary information, and therefore could be be revealed.

Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Proteins and Enzymes