OX40/TNFRSF4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69156

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to TNFRSF4 (tumor necrosis factor receptor superfamily, member 4) The peptide sequence was selected from the middle region of TNFRSF4. Peptide sequence GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for OX40/TNFRSF4 Antibody - BSA Free

Western Blot: OX40/TNFRSF4 Antibody [NBP1-69156]

Western Blot: OX40/TNFRSF4 Antibody [NBP1-69156]

Western Blot: OX40/TNFRSF4 Antibody [NBP1-69156] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for OX40/TNFRSF4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OX40/TNFRSF4

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.

Alternate Names

ACT-135, ACT35 antigen, ACT35ATC35 antigen, CD134, CD134 antigen, Ly-70, OX40 cell surface antigen, OX40 homologue, OX40L receptor, OX40lymphoid activation antigene ACT35, TAX transcriptionally-activated glycoprotein 1 receptor, tax-transcriptionally activated glycoprotein 1 receptor, TNFRSF4, tumor necrosis factor receptor superfamily member 4, tumor necrosis factor receptor superfamily, member 4, Txgp1, TXGP1L, TXGP1LOX40 antigen

Gene Symbol

TNFRSF4

UniProt

Additional OX40/TNFRSF4 Products

Product Documents for OX40/TNFRSF4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OX40/TNFRSF4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OX40/TNFRSF4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OX40/TNFRSF4 Antibody - BSA Free and earn rewards!

Have you used OX40/TNFRSF4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...