p190RhoGAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80051

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human GRLF1. Peptide sequence RPSADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

171 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for p190RhoGAP Antibody - BSA Free

Western Blot: p190RhoGAP Antibody [NBP1-80051]

Western Blot: p190RhoGAP Antibody [NBP1-80051]

Western Blot: p190RhoGAP Antibody [NBP1-80051] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for p190RhoGAP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p190RhoGAP

The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. [provided by RefSeq]

Alternate Names

glucocorticoid receptor DNA binding factor 1, glucocorticoid receptor DNA-binding factor 1, glucocorticoid receptor repression factor 1, GRF1, GRF-1, GRLF1, KIAA1722, MGC10745, P190A, P190-A, p190ARhoGAP, p190RhoGAP, rho GAP p190A, Rho GTPase activating protein 35, rho GTPase-activating protein 35

Gene Symbol

ARHGAP35

Additional p190RhoGAP Products

Product Documents for p190RhoGAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for p190RhoGAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p190RhoGAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p190RhoGAP Antibody - BSA Free and earn rewards!

Have you used p190RhoGAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...