PAMCI Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09529

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PAMCI Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAMCI (NP_005438). Peptide sequence KEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PAMCI Antibody - BSA Free

Western Blot: PAMCI Antibody [NBP3-09529]

Western Blot: PAMCI Antibody [NBP3-09529]

Western Blot: PAMCI Antibody [NBP3-09529] - Western blot analysis of PAMCI in Human U937 Whole Cell. Antibody dilution at 1ug/ml

Applications for PAMCI Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAMCI

The protein encoded by the PAMCI gene localizes to perinuclear endosomes. This protein associates with peptidylglycine alpha-amidating monooxygenase, and may be involved with the trafficking of this enzyme through secretory or endosomal pathways. (provided by RefSeq)

Alternate Names

PAM COOH-terminal interactor protein 1, PAMCI, PCIP1, P-CIP1peptidylglycine alpha-amidating monooxygenase COOH-terminal interactorprotein-1, Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor, Ras association (RalGDS/AF-6) domain family (N-terminal) member 9, ras association domain-containing protein 9

Gene Symbol

RASSF9

Additional PAMCI Products

Product Documents for PAMCI Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAMCI Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAMCI Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAMCI Antibody - BSA Free and earn rewards!

Have you used PAMCI Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies