PAQR4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83356

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human PAQR4. Peptide sequence: GWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PAQR4 Antibody - BSA Free

Western Blot: PAQR4 Antibody [NBP2-83356]

Western Blot: PAQR4 Antibody [NBP2-83356]

Western Blot: PAQR4 Antibody [NBP2-83356] - Host: Rabbit. Target Name: PAQR4. Sample Tissue: Human Lymph Node Tumor lysates. Antibody Dilution: 1ug/ml
Western Blot: PAQR4 Antibody [NBP2-83356]

Western Blot: PAQR4 Antibody [NBP2-83356]

Western Blot: PAQR4 Antibody [NBP2-83356] - Host: Rabbit. Target Name: PAQR4. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 3ug/ml
PAQR4 Antibody - BSA Free

Western Blot: PAQR4 Antibody - BSA Free [NBP2-83356] -

Expression of PAQR4 in cancer tissues and cancer cell lines. (A) The mRNA expression of PAQR4 in BLCA tissues. (B) Immunohistochemistry: Negative for PAQR4 in normal kidney tissue; Renal clear cell carcinoma tissue positive for PAQR4. (C) Immunohistochemistry: Negative for PAQR4 in normal bladder tissue; Bladder cancer tissue positive for PAQR4. (D–E) The mRNA and protein expression of PAQR4 in bladder cancer cell lines 5637, T24, and renal clear cell carcinoma cell lines CAKI1, 786-O.(F–G) Knockdown efficacy in T24 and 786-O cells. All experiments were repeated at least three times. *, **, ***, **** represent P-value < 0.05, P-value < 0.01, P-value < 0.001, and P-value < 0.0001, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36481756), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PAQR4 Antibody - BSA Free

Western Blot: PAQR4 Antibody - BSA Free [NBP2-83356] -

Expression of PAQR4 in cancer tissues and cancer cell lines. (A) The mRNA expression of PAQR4 in BLCA tissues. (B) Immunohistochemistry: Negative for PAQR4 in normal kidney tissue; Renal clear cell carcinoma tissue positive for PAQR4. (C) Immunohistochemistry: Negative for PAQR4 in normal bladder tissue; Bladder cancer tissue positive for PAQR4. (D–E) The mRNA and protein expression of PAQR4 in bladder cancer cell lines 5637, T24, and renal clear cell carcinoma cell lines CAKI1, 786-O.(F–G) Knockdown efficacy in T24 and 786-O cells. All experiments were repeated at least three times. *, **, ***, **** represent P-value < 0.05, P-value < 0.01, P-value < 0.001, and P-value < 0.0001, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36481756), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PAQR4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAQR4

Alternate Names

progestin and adipoQ receptor family member 4, progestin and adipoQ receptor family member IVFLJ30002

Gene Symbol

PAQR4

Additional PAQR4 Products

Product Documents for PAQR4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAQR4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PAQR4 Antibody - BSA Free

Customer Reviews for PAQR4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAQR4 Antibody - BSA Free and earn rewards!

Have you used PAQR4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...