PARN Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80250

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PARN Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human PARN. Peptide sequence IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PARN Antibody - BSA Free

Western Blot: PARN Antibody [NBP1-80250]

Western Blot: PARN Antibody [NBP1-80250]

Western Blot: PARN Antibody [NBP1-80250] - Lanes: Lane 1 : 7ug HEK293 cytoplasmic lysate 2: 7ug HEK293 nuclei lysate Primary, Antibody Dilution: 1 : 500 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: PARN.
Western Blot: PARN Antibody [NBP1-80250]

Western Blot: PARN Antibody [NBP1-80250]

Western Blot: PARN Antibody [NBP1-80250] - SP2/0 cell lysate, concentration 1.25ug/ml.

Applications for PARN Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PARN

Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. The amino acid sequence of poly(A)-specific ribonuclease shows homology to the RNase D family of 3'-exonucleases. The protein appears to be localized in both the nucleus and the cytoplasm. It is not stably associated with polysomes or ribosomal subunits.

Alternate Names

DANEC 3.1.13.4, Deadenylating nuclease, Deadenylation nuclease, poly(A)-specific ribonuclease (deadenylation nuclease), poly(A)-specific ribonuclease PARN, Polyadenylate-specific ribonuclease

Gene Symbol

PARN

UniProt

NP_083037 (Mouse)

Additional PARN Products

Product Documents for PARN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PARN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PARN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PARN Antibody - BSA Free and earn rewards!

Have you used PARN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies