PCBD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88016

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PCBD2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of PCBD2. Peptide sequence: NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PCBD2 Antibody - BSA Free

Western Blot: PCBD2 Antibody [NBP2-88016]

Western Blot: PCBD2 Antibody [NBP2-88016]

Western Blot: PCBD2 Antibody [NBP2-88016] - WB Suggested Anti-PCBD2 Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell

Applications for PCBD2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCBD2

PCBD2, also known as Pterin-4-alpha-carbinolamine dehydratase 2, is a 130 amino acid protein that is 14 kDa, involved in tetrahydrobiopterin biosynthesis preventing the formation of 7-pterins and accelerating the formation of quinonoid-BH2, also being known to regulate the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. The protein is being studied for its involvement in hyperphenylalaninemia. The PCBD2 has also been shown to have interactions with DYRK1B, AATF, ASCC2, C1D, and CHAF1A in pathways such as phenylalanine degradation I (aerobic) pathway.

Alternate Names

4-alpha-hydroxy-tetrahydropterin dehydratase 2, DCOH2DCOHMPHS2,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2, DcoH-like protein DCoHm, dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle, dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1), Dimerization cofactor of hepatocyte nuclear factor 1 from muscle, EC 4.2.1.96, HNF-1-alpha dimerization cofactor, PHS 2, pterin-4 alpha-carbinolamine dehydratase 2, pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2, pterin-4-alpha-carbinolamine dehydratase 2

Gene Symbol

PCBD2

Additional PCBD2 Products

Product Documents for PCBD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCBD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCBD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCBD2 Antibody - BSA Free and earn rewards!

Have you used PCBD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies