PCPTP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62412

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PTPRR(protein tyrosine phosphatase, receptor type, R) The peptide sequence was selected from the N terminal of PTPRR. Peptide sequence TATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PCPTP1 Antibody - BSA Free

Western Blot: PCPTP1 Antibody [NBP1-62412]

Western Blot: PCPTP1 Antibody [NBP1-62412]

Western Blot: PCPTP1 Antibody [NBP1-62412] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for PCPTP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCPTP1

PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP. The similar gene predominately expressed in mouse brain was found to associate with, and thus regulate the activity and cellular localization of MAP kinases. The rat counterpart of this gene was reported to be regulated by the nerve growth factor, which suggested the function of this gene in neuronal growth and differentiation.

Alternate Names

Ch-1 PTPase, ch-1PTPase, DKFZp781C1038, EC 3.1.3.48, ECPTP, EC-PTP, FLJ34328, MGC131968, MGC148170, NC-PTPCOM1, PCPTP1, protein tyrosine phosphatase Cr1PTPase, protein tyrosine phosphatase, receptor type, R, protein-tyrosine phosphatase NC-PTPCOM1, Protein-tyrosine phosphatase PCPTP1, PTPBR7, PTPRQ, PTP-SL, receptor-type tyrosine-protein phosphatase R, R-PTP-R

Gene Symbol

PTPRR

UniProt

Additional PCPTP1 Products

Product Documents for PCPTP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCPTP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCPTP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCPTP1 Antibody - BSA Free and earn rewards!

Have you used PCPTP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...