PEMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-11004

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PEMT Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse PEMT (NP_001276940.1). Peptide sequence NPMYWGSTANYLGWALMHASPTGLLLTVLVAIVYVVALLYEEPFTAEIYR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PEMT Antibody - BSA Free

Western Blot: PEMT Antibody [NBP3-11004]

Western Blot: PEMT Antibody [NBP3-11004]

Western Blot: PEMT Antibody [NBP3-11004] - Western blot analysis of PEMT in Mouse Small Intestine lysates. Antibody dilution at 1ug/ml

Applications for PEMT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PEMT

PEMT also known as Phosphatidylethanolamine N-methyltransferase, has 3 isoforms, a 199 amino acid isoform that is 22 kDa, a 236 amino acid that is 26 kDa, and 232 amino acid isoform that is 25 kDa, converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver and localizes to the endoplasmic reticulum and mitochondria-associated membranes. This protein is being studied for its involvement in ceroid lipofuscinosis, neuronal ceroid-lipofuscinosis, smith-magenis syndrome, spina bifida, orofacial cleft, whiplash, fatty liver disease, liver disease, cystic fibrosis, hepatocellular carcinoma, Alzheimer's disease, gigantism, breast cancer, liver cancer, homocysteine, fibrosis, alcoholism, endometriosis, gastric cancer, and infertility. The protein has been linked to the glycerophospholipid biosynthesis, metabolism, phospholipid metabolism, synthesis of PC, metabolism of lipids and lipoproteins, acetylcholine synthesis, and acetylcholine synthesis pathways where it interacts with CALM1, CALM2, CALM3, ALG5, ALG6, ALG8, EMC3, FEN1, and over 180 other proteins.

Alternate Names

EC 2.1.1.17, PEMPTMGC2483, PEMT2PEAMT, phosphatidylethanolamine N-methyltransferase, PNMT

Gene Symbol

PEMT

Additional PEMT Products

Product Documents for PEMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PEMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PEMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PEMT Antibody - BSA Free and earn rewards!

Have you used PEMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies