PFKFB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84217

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of PFKFB1. Peptide sequence: EEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELER The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PFKFB1 Antibody - BSA Free

Western Blot: PFKFB1 Antibody [NBP2-84217]

Western Blot: PFKFB1 Antibody [NBP2-84217]

Western Blot: PFKFB1 Antibody [NBP2-84217] - WB Suggested Anti-PFKFB1 Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell
Western Blot: PFKFB1 Antibody [NBP2-84217]

Western Blot: PFKFB1 Antibody [NBP2-84217]

Western Blot: PFKFB1 Antibody [NBP2-84217] - WB Suggested Anti-PFKFB1 Antibody. Positive Control: Lane 1: 40ug HEK293 lysate Lane 2: 40ug H1299 lysate. Primary Antibody Dilution : 1:1000. Secondary Antibody : Goat anti-rabbit-HRP. Secondry Antibody Dilution : 1:5000. Submitted by: Jose Luis Rosa, Universitat de Barcelona

Applications for PFKFB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PFKFB1

Phosphofructokinases (PFK) are regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2), and ADP. Human PFK-1 is tetrameric and isoenzymes include, PFK-1 muscle (PFKM, PFK-A), PFK-1 liver (PFKL, PFK-B), and PFK-1 platelet (PFKP, PFK-C, PFKF). PFK-1 is inhibited by ATP and citrate (from the tricarboxylic acid cycle). PFK-1 undergoes activation in the presence of elevated AMP. The most potent activator is fructose-2,6-bisphosphate, which is produced by PFK-2 from the same substrate, fructose 6-phosphate. PFK-2 is bifunctional and a key regulator for PFK-1. PFK-2 catalyzes the synthesis of fructose-2,6-bisphosphate, and contains fructose-2,6-biphosphatase activity that catalyzes the degradation of fructose-2,6-bisphosphate. PFK-2 is dimeric and isoenzymes include PFK-2 liver (PFKFB1, PFRX), PFK-2 cardiac (PFKFB2), PFK-2 placental (PFKFB3, inducible PFK-2) and PFK-2 testis (PFKFB4).

Alternate Names

2-kinase:fructose-2,6-bisphosphatase, 6PF-2-K/Fru-2,6-P2ase liver isozyme, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, F6PK, fructose-6-phosphate, MGC116715,6PF-2-K/Fru-2,6-P2ase 1, MGC116717, PFK/FBPase 1, PFRXHL2K

Gene Symbol

PFKFB1

Additional PFKFB1 Products

Product Documents for PFKFB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PFKFB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PFKFB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PFKFB1 Antibody - BSA Free and earn rewards!

Have you used PFKFB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...