PHF15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88043

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PHF15 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PHF15. Peptide sequence: MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PHF15 Antibody - BSA Free

Western Blot: PHF15 Antibody [NBP2-88043]

Western Blot: PHF15 Antibody [NBP2-88043]

Western Blot: PHF15 Antibody [NBP2-88043] - Host: Rabbit. Target Name: PHF15. Sample Type: Human muscle. Antibody Dilution: 1.0ug/ml

Applications for PHF15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHF15

PHF15, also known as Protein Jade-2, has 3 isoforms, a 790 amino acid isoform that is 87 kDa, a 789 amino acid isoform that is 87 kDa and a 562 amino acid isoform that is 63 kDa, has a histone H4-specific acetyltransferase activity as a component of the HBO1complex, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. This protein has been shown an interaction with ING4, KAT7, ING5, PACSIN, ZBTB3, ZBTB5, ZNF496, and VHL proteins in histone H3 acetylation, histone H4-K5 acetylation, histone H4-K8 acetylation, and histone H4-K12 acetylation biological processes.

Alternate Names

PHD finger protein 15KIAA0239JADE2, protein Jade-2

Gene Symbol

PHF15

Additional PHF15 Products

Product Documents for PHF15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PHF15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHF15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHF15 Antibody - BSA Free and earn rewards!

Have you used PHF15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies