PIEZO2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-89893PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIEZO2.

Source: E. coli

Amino Acid Sequence: ESEKPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89893.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-89893PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PIEZO2

Coming from the Greek ''piesi'' and meaning "pressure", PIEZO2 is integral to the membrane and is involved in ion channel activity, cation channel activity and the regulation of membrane potential. Having between 24 and 36 transmembrane domains, PIEZO's are big transmembrane proteins found in a variety of species. More specifically, PIEZO2 is required for rapidly adapting mechanically activated current in somatosensory and DRG neurons.

Long Name

PIEZO2

Alternate Names

C18orf30, C18orf58, DA3, DA5, DAIPT, FAM38B, FAM38B2, family with sequence similarity 38, member A pseud, family with sequence similarity 38, member B2, HsT748, HsT771, MWKS, piezo-type mechanosensitive ion channel component

Gene Symbol

PIEZO2

Additional PIEZO2 Products

Product Documents for PIEZO2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIEZO2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PIEZO2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PIEZO2 Recombinant Protein Antigen and earn rewards!

Have you used PIEZO2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for PIEZO2 Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q: In my project we need Anti Piezo2 and we find it in your catalogs. PIEZO2 Antibody. I want to know the prediction size of your antibody. The size of the protein is more than 200 kd. but in this photo there there are some sharp band are there the actual bands?

    A: The predicted molecular weights for this protein are based on the multiple transcripts associated with this protein. Please see Ensembl for detailed information. Those expected molecular weights are the following: 318.1, 80.8, 73.8, 62.7 kDa. We see this kind of staining across many of our antibodies for PIEZO2. It would appear that the transcript present is dependent on the tissue type. Based on protein arrays, we do believe that this antibody is specific.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...