PIGC Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79871

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PIGC Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human PIGCThe immunogen for this antibody is PIGC. Peptide sequence AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PIGC Antibody - BSA Free

Western Blot: PIGC Antibody [NBP1-79871]

Western Blot: PIGC Antibody [NBP1-79871]

Western Blot: PIGC Antibody [NBP1-79871] - Titration: 1.0 ug/ml Positive Control: Fetal Lung.
Western Blot: PIGC Antibody [NBP1-79871]

Western Blot: PIGC Antibody [NBP1-79871]

Western Blot: PIGC Antibody [NBP1-79871] - Human 293T, Antibody Dilution: 1.0 ug/ml PIGC is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Applications for PIGC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIGC

PIGC, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit C, is 297 amino acids in length and approximately 34 kDa. PIGC is an important player in GPI anchor biosynthesis because it catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol. Current research on PIGC is being performed relating to several diseases and disorders including malaria and lassa fever. PIGC has also been shown to have interactions with PIGA, DPM2, KLF10, PIGQ and ZHX1 in pathways such as GPI anchor biosynthesis and metabolic pathways.

Alternate Names

EC 2.4.1.198, GPI2class C protein, MGC2049, phosphatidylinositol glycan anchor biosynthesis, class C, phosphatidylinositol glycan, class C

Gene Symbol

PIGC

UniProt

NP_002633 (Human)

Additional PIGC Products

Product Documents for PIGC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PIGC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIGC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIGC Antibody - BSA Free and earn rewards!

Have you used PIGC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies