Pinin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59136

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Pinin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PNN(pinin, desmosome associated protein) The peptide sequence was selected from the N terminal of PNN. Peptide sequence MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Pinin Antibody - BSA Free

Western Blot: Pinin Antibody [NBP1-59136]

Western Blot: Pinin Antibody [NBP1-59136]

Western Blot: Pinin Antibody [NBP1-59136] - Hela, Antibody Dilution: 1.0 ug/ml PNN is strongly supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: Pinin Antibody [NBP1-59136]

Western Blot: Pinin Antibody [NBP1-59136]

Western Blot: Pinin Antibody [NBP1-59136] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Pinin Antibody [NBP1-59136]

Western Blot: Pinin Antibody [NBP1-59136]

Western Blot: Pinin Antibody [NBP1-59136] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml PNN is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Applications for Pinin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Pinin

PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent mul

Alternate Names

140 kDa nuclear and cell adhesion-related phosphoprotein, Desmosome-associated protein, Domain-rich serine protein, DRS protein, DRSP, DRSSR-like protein, Melanoma metastasis clone A protein, memA, neutrophil protein, Nuclear protein SDK3, pinin, pinin, desmosome associated protein, SDK3

Gene Symbol

PNN

Additional Pinin Products

Product Documents for Pinin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Pinin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pinin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Pinin Antibody - BSA Free and earn rewards!

Have you used Pinin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies