Plexin A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56699

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Plexin A3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA

Reactivity Notes

Mouse 84%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Plexin A3 Antibody - BSA Free (NBP2-56699) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Plexin A3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Plexin A3 Antibody [NBP2-56699]

Immunocytochemistry/ Immunofluorescence: Plexin A3 Antibody [NBP2-56699]

Immunocytochemistry/Immunofluorescence: Plexin A3 Antibody [NBP2-56699] - Staining of human cell line MCF7 shows localization to nucleus, cell junctions & vesicles.

Applications for Plexin A3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Plexin A3

Plexin A3, also known by its gene name PLXNA3, has 1,871 amino acids and is approximately 208kDa. Plexin A3 is a cell surface, transmembrane protein that is a member of the Plexin family. Plexin A3 is thought to play a role in the development of neural tissue and epithelial tissue, as well as function in axon guidance. Current research on Plexin A3 is being performed in relation to several diseases and disorders including Rett syndrome, neuronitis and ovarian cancer. Plexin A3 has also been shown to have interactions with SMN1, SMN2, MAPK8IP2, CBFA2T3 and CSNK2B in pathways such as the axon guidance pathway and the Semaphorin signaling pathway.

Alternate Names

Plxn3, PLXN4, PLXNA3, SEX, XAP-6

Gene Symbol

PLXNA3

Additional Plexin A3 Products

Product Documents for Plexin A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Plexin A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Plexin A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Plexin A3 Antibody - BSA Free and earn rewards!

Have you used Plexin A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies