POLR3F Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52916

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to POLR3F(polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa) The peptide sequence was selected from the middle region of POLR3F. Peptide sequence LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: RPC6.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for POLR3F Antibody - BSA Free

Western Blot: POLR3F Antibody [NBP1-52916]

Western Blot: POLR3F Antibody [NBP1-52916]

Western Blot: POLR3F Antibody [NBP1-52916] - Human 293T, Antibody Dilution: 1.0 ug/ml POLR3F is supported by BioGPS gene expression data to be expressed in HEK293T.
Western Blot: POLR3F Antibody [NBP1-52916]

Western Blot: POLR3F Antibody [NBP1-52916]

Western Blot: POLR3F Antibody [NBP1-52916] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for POLR3F Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLR3F

POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.The protein encoded by this gene is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.

Alternate Names

DNA-directed RNA polymerase III 39 kDa polypeptide, DNA-directed RNA polymerase III subunit F, DNA-directed RNA polymerase III subunit RPC6, DNA-directed RNA polymerases III 39 kDa polypeptide, polymerase (RNA) III (DNA directed) polypeptide F (39 kDa), polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa, RNA polymerase III 39 kDa subunit, RNA polymerase III C39 subunit, RNA polymerase III subunit C6, RPC39MGC13517, RPC6

Gene Symbol

POLR3F

UniProt

Additional POLR3F Products

Product Documents for POLR3F Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POLR3F Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POLR3F Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLR3F Antibody - BSA Free and earn rewards!

Have you used POLR3F Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...