Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10009

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Polypeptide GalNac Transferase 7/GALNT7 (NP_059119.2). Peptide sequence LLVVGSFLGLVVLWSSLTPRPDDPSPLSRMREDRDVNDPMPNRGGNGLAP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP3-10009]

Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP3-10009]

Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP3-10009] - Western blot analysis of Polypeptide GalNac Transferase 7/GALNT7 in Breast Tumor lysates. Antibody dilution at 1ug/ml

Applications for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Polypeptide GalNAc Transferase 7/GALNT7

GALNT7 encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation.

Long Name

UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7

Alternate Names

GALNAC-T7, GalNAcT7, pp-GaNTase 7

Gene Symbol

GALNT7

Additional Polypeptide GalNAc Transferase 7/GALNT7 Products

Product Documents for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free and earn rewards!

Have you used Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...