POPDC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84225

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all POPDC3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of POPDC3. Peptide sequence: PEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQHRYISRLFSV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for POPDC3 Antibody - BSA Free

Western Blot: POPDC3 Antibody [NBP2-84225]

Western Blot: POPDC3 Antibody [NBP2-84225]

Western Blot: POPDC3 Antibody [NBP2-84225] - WB Suggested Anti-Popdc3 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Liver

Applications for POPDC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POPDC3

POPDC3 encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development. Alternatively spliced transcript variants have been found. [provided by RefSeq]

Alternate Names

bA355M14.1, MGC22671, POP3RP11-99L11.2, popeye domain containing 3, popeye domain-containing protein 3, Popeye protein 3

Gene Symbol

POPDC3

Additional POPDC3 Products

Product Documents for POPDC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POPDC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POPDC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POPDC3 Antibody - BSA Free and earn rewards!

Have you used POPDC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies