PPP2R1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85516

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PPP2R1B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PPP2R1B. Peptide sequence: SELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALAL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PPP2R1B Antibody - BSA Free

Western Blot: PPP2R1B Antibody [NBP2-85516]

Western Blot: PPP2R1B Antibody [NBP2-85516]

Western Blot: PPP2R1B Antibody [NBP2-85516] - Host: Rabbit. Target Name: PPP2R1B. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for PPP2R1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPP2R1B

The PPP2R1B gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co

Alternate Names

MGC26454, PP2A subunit A isoform PR65-beta, PP2A subunit A isoform R1-beta, PP2A, subunit A, PR65-beta isoform, PP2A, subunit A, R1-beta isoform, PP2A-Abeta, PR65B, protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform, protein phosphatase 2, regulatory subunit A, beta, protein phosphatase 2, structural/regulatory subunit A, beta, serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A betaisoform

Gene Symbol

PPP2R1B

Additional PPP2R1B Products

Product Documents for PPP2R1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPP2R1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPP2R1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPP2R1B Antibody - BSA Free and earn rewards!

Have you used PPP2R1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies