PPT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86755

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PPT2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPT2. Peptide sequence: DLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PPT2 Antibody - BSA Free

Western Blot: PPT2 Antibody [NBP2-86755]

Western Blot: PPT2 Antibody [NBP2-86755]

Western Blot: PPT2 Antibody [NBP2-86755] - Host: Rabbit. Target Name: PPT2. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Applications for PPT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPT2

PPT2 encodes a member of the palmitoyl-protein thioesterase family. The encoded glycosylated lysosomal protein has palmitoyl-CoA hydrolase activity in vitro, but does not hydrolyze palmitate from cysteine residues in proteins. Three transcript variants encoding different isoforms have been described for this gene, with one of the isoforms being inactive. [provided by RefSeq]

Alternate Names

C6orf8, DKFZp564P1516, EC 3.1.2, EC 3.1.2.-, G14, lysosomal thioesterase PPT2, palmitoyl-protein hydrolase 2, palmitoyl-protein thioesterase 2, PPT-2, S-thioesterase G14, VE-statin2

Gene Symbol

PPT2

Additional PPT2 Products

Product Documents for PPT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPT2 Antibody - BSA Free and earn rewards!

Have you used PPT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies