PRCC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85425

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PRCC Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat PRCC. Peptide sequence: KKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PRCC Antibody - BSA Free

Western Blot: PRCC Antibody [NBP2-85425]

Western Blot: PRCC Antibody [NBP2-85425]

Western Blot: PRCC Antibody [NBP2-85425] - Host: Rabbit. Target Name: Prcc. Sample Type: Rat Heart lysates. Antibody Dilution: 1.0ug/ml

Applications for PRCC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRCC

In a subset of papillary renal cell carcinomas, a t(X;1)(p11;q21) chromosome translocation has been repeatedly reported and is thought to be the cause of the cancer. As a result of the translocation, the transcription factor TFE3 on the X chromosome becomes fused to the PRCC (papillary renal cell carcinoma translocation-associated) gene on chromosome 1. The fused gene results in the fusion of N-terminal proline-rich region of the protein encoded by this gene to the entire TFE3 protein. This protein has been shown to interact with the mitotic checkpoint protein MAD2B, which suggests that the dominant-negative effect of the fusion protein with TFE3 may lead to a mitotic checkpoint defect.

Alternate Names

MGC17178, papillary renal cell carcinoma (translocation-associated), Papillary renal cell carcinoma translocation-associated gene protein, proline-rich protein PRCC, RCCP1MGC4723, TPRC

Gene Symbol

PRCC

Additional PRCC Products

Product Documents for PRCC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PRCC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRCC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRCC Antibody - BSA Free and earn rewards!

Have you used PRCC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies