PREX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88090

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PREX2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PREX2. Peptide sequence: ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PREX2 Antibody - BSA Free

Western Blot: PREX2 Antibody [NBP2-88090]

Western Blot: PREX2 Antibody [NBP2-88090]

Western Blot: PREX2 Antibody [NBP2-88090] - Host: Rabbit. Target Name: PREX2. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: PREX2 Antibody [NBP2-88090]

Western Blot: PREX2 Antibody [NBP2-88090]

Western Blot: PREX2 Antibody [NBP2-88090] - Host: Rabbit. Target Name: PREX2. Sample Tissue: Human Lung Tumor. Antibody Dilution: 1ug/ml

Applications for PREX2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PREX2

PREX2 functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDPfor free GTP. Its activity is synergistically activated by phosphatidylinositol-3,4,5-triphosphate and the beta gammasubunits of heterotrimeric G

Alternate Names

DEP domain-containing protein 2, DEP.2, DEPDC2, phosphatidylinositol 34,5-trisphosphate-dependent Rac exchanger 2 protein, phosphatidylinositol-34,5-trisphosphate-dependent Rac exchange factor 2, P-REX2,6230420N16Rik, PtdIns(34,5)-dependent Rac exchanger 2

Gene Symbol

PREX2

Additional PREX2 Products

Product Documents for PREX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PREX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PREX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PREX2 Antibody - BSA Free and earn rewards!

Have you used PREX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies