Home / GIP Receptor Agonists / [Pro3]-GIP (Rat)

[Pro3]-GIP (Rat)

Catalog #: 5837 Datasheet / COA / SDS

Discontinued Product

5837 has been discontinued.
View all GIP Receptor Agonists products.
[Pro3]-GIP (Rat)
1 Image
Description: High affinity rat GIP partial agonist
Product Details
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

[Pro3]-GIP (Rat) is a high affinity rat GIP receptor partial agonist (Kd = 13 nM). Increases cAMP accumulation in COS-7 cells transfected with rat GIP receptor, while also acting as a competitive antagonist of GIP.

Technical Data

M.Wt:
4970.63
Formula:
C226H343N61O64S
Sequence:
YAPGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for [Pro3]-GIP (Rat)

There are currently no reviews for this product. Be the first to review [Pro3]-GIP (Rat) and earn rewards!

Have you used [Pro3]-GIP (Rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.