Recombinant S. aureus Protein A Protein

Novus Biologicals | Catalog # NBP3-07005

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

SDS-PAGE
Loading...

Product Specifications

Description

An un-tagged recombinant protein corresponding to the amino acids 37-469 of Protein A

Source: E.coli

Amino Acid Sequence: MAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDNKKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPET

Purity

>90%, by SDS-PAGE

Endotoxin Level

< 1.0 EU per 1 microgram of protein (determined by LAL method)

Predicted Molecular Mass

48.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant S. aureus Protein A Protein

SDS-PAGE: Recombinant S. aureus Protein A Protein [NBP3-07005]

SDS-PAGE: Recombinant S. aureus Protein A Protein [NBP3-07005]

SDS-Page: Recombinant S. aureus Protein A Protein [NBP3-07005] - Protein A, 48.1 kDa (434aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE.

Formulation, Preparation, and Storage

NBP3-07005
Formulation 20 mM Tris-HCl buffer (pH 8.0), 10% glycerol
Preservative No Preservative
Concentration 1 mg/ml
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protein A

Protein A is a surface protein of S.aureus which binds IgG molecules by their Fc region. In serum, the bacteria will bind IgG molecules in the wrong orientation on their surface which hinders opsonization and phagocytosis. Mutants of S. aureus lacking protein A are more efficiently phagocytosed in vitro, and mutants in infection models have diminished virulence. Due to its affinity for the Fc region of many mammalian immunoglobulins, protein A is considered a universal reagent in biochemistry and immunology.

Alternate Names

PROA, Protein-A

Gene Symbol

SAOUHSC_00069

Additional Protein A Products

Product Documents for Recombinant S. aureus Protein A Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant S. aureus Protein A Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant S. aureus Protein A Protein

There are currently no reviews for this product. Be the first to review Recombinant S. aureus Protein A Protein and earn rewards!

Have you used Recombinant S. aureus Protein A Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant S. aureus Protein A Protein

Showing  1 - 11 FAQ Showing All
  • Q: During my master thesis, I am working on a large scale ribosome affinity purification in Trypanosoma brucei. Unfortunately, we have some problems with the present antibody (IgG against protein A, extracted from chicken). Therefore, we are searching a better and more efficient alternative. Ideally it is extracted from guinea pig, rat, mouse or rabbit. Searching suitable antibodies, I found you have some in your range of products. Since we need to work large scale and will need a bigger amount of antibodies the next months, we would like to get the possibility to test the new antibodies first. Therefore I would like to ask for an aliquot for testing. You would really help me finding an good alternative!

    A:

    We unfortunately cannot offer testing samples of our antibodies. I am sorry for any inconvenience. We do have two antibodies to Protein A that meet your host requirements. We fully guarantee our antibodies for all listed species and applications. For any applications and/or species not listed, we offer our Innovators Reward Program. In exchange for a review of your experiment using our product in an untested application or species, we will issue you a credit for the purchase price of the antibody.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...