Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3)

Novus Biologicals | Catalog # NBP3-16292

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9C6B3 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 312-404 of human Protein Kinase A Regulatory Subunit II alpha (P13861). SRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3)

Western Blot: Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3) [NBP3-16292]

Western Blot: Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3) [NBP3-16292]

Western Blot: Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3) [NBP3-16292] - Western blot analysis of extracts of various cell lines, using Protein Kinase A Regulatory Subunit II alpha Rabbit mAb (NBP3-16292) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Applications for Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PKA RII alpha

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of cAMP-dependent protein kinase. This subunit has been shown to regulate protein transport from endosomes to the Golgi apparatus and further to the endoplasmic reticulum (ER). [provided by RefSeq, Jul 2008]

Long Name

cAMP-dependent Protein Kinase Regulatory Type II alpha

Alternate Names

PRKAR2A

Gene Symbol

PRKAR2A

Additional PKA RII alpha Products

Product Documents for Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3)

There are currently no reviews for this product. Be the first to review Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3) and earn rewards!

Have you used Protein Kinase A Regulatory Subunit II alpha Antibody (9C6B3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...