Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PSG9(pregnancy specific beta-1-glycoprotein 9) The peptide sequence was selected from the N terminal of PSG9. Peptide sequence YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.

Applications for PSG9 Antibody [Biotin]

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP1-57676. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: PSG9

The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).(supplied by OMIM)

Alternate Names

pregnancy specific beta-1-glycoprotein 9, Pregnancy-specific beta-1 glycoprotein B, Pregnancy-specific beta-1-glycoprotein 11, pregnancy-specific beta-1-glycoprotein 9, Pregnancy-specific glycoprotein 11, Pregnancy-specific glycoprotein 7, Pregnancy-specific glycoprotein 9, PS34, PS-beta-B, PS-beta-G-11, PS-beta-G-9, PSBG-11, PSBG-9, PSG11pregnancy specific beta-1-glycoprotein 11, PSG7, PSGII

Gene Symbol

PSG9

Additional PSG9 Products

Product Documents for PSG9 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSG9 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSG9 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review PSG9 Antibody [Biotin] and earn rewards!

Have you used PSG9 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...