PSMC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91476

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PSMC1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PSMC1 Antibody - BSA Free

Western Blot: PSMC1 Antibody [NBP1-91476]

Western Blot: PSMC1 Antibody [NBP1-91476]

Western Blot: PSMC1 Antibody [NBP1-91476] - Lane 1: 10 ug proteasome fraction from C57B1/6J mouse brain, lane 2: 10 ug proteasome fraction from BLAB/C mouse brain. Primary PSMC1 antibody at 1:500. Secondary antibody: Anti-rabbit HRP antibody at 1:5000.
Western Blot: PSMC1 Antibody [NBP1-91476]

Western Blot: PSMC1 Antibody [NBP1-91476]

Western Blot: PSMC1 Antibody [NBP1-91476] - Mouse Brain lysate, PSMC1 antibody a 1 ug/mL.
Simple Western: PSMC1 Antibody [NBP1-91476]

Simple Western: PSMC1 Antibody [NBP1-91476]

Simple Western: PSMC1 Antibody [NBP1-91476] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this PSMC1 antibody. Simple Western image submitted by a verified customer review.

Applications for PSMC1 Antibody - BSA Free

Application
Recommended Usage

Simple Western

1:25

Western Blot

1.0 ug/ml
Application Notes
This PSMC1 antibody is validated for Simple Western from a verified customer review.
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse whole spleen lysates, separated by Size, antibody dilution of 1:25

Reviewed Applications

Read 1 review rated 4 using NBP1-91476 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMC1

Alternate Names

26S protease regulatory subunit 4, 26S proteasome AAA-ATPase subunit RPT2, MGC24583, P26S4, p56, proteasome (prosome, macropain) 26S subunit, ATPase, 1, proteasome 26S ATPase subunit 1, Proteasome 26S subunit ATPase 1, proteasome 26S subunit, ATPase, 1, S4MGC8541

Entrez Gene IDs

5700 (Human); 19179 (Mouse)

Gene Symbol

PSMC1

UniProt

P62192 (Mouse)

Additional PSMC1 Products

Product Documents for PSMC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PSMC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSMC1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PSMC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • PSMC1 Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: Mouse Spleen Lysate
    Species: Mouse
    Verified Customer | Posted 08/23/2019
    Whole-spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this antibody.
    PSMC1 Antibody - BSA Free NBP1-91476

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies