PSTPIP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85846

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVNPKQQEKLFVKLATSKTAVEDSDKAYMLHIGTLDKVREEWQSEHIKACEAFEAQECERINFFRNALWLHVNQLSQQC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSTPIP2 Antibody - BSA Free

PSTPIP2 Antibody - BSA Free Immunohistochemistry-Paraffin: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Immunohistochemistry-Paraffin: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
PSTPIP2 Antibody - BSA Free Immunohistochemistry-Paraffin: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Immunohistochemistry-Paraffin: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Staining of human kidney shows no positivity in cells in tubules as expected.
PSTPIP2 Antibody - BSA Free Immunohistochemistry-Paraffin: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Immunohistochemistry-Paraffin: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Staining of human cerebral cortex shows no positivity in neurons as expected.
PSTPIP2 Antibody - BSA Free Western Blot: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Western Blot: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
PSTPIP2 Antibody - BSA Free Western Blot: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Western Blot: PSTPIP2 Antibody - BSA Free [NBP1-85846]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for PSTPIP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSTPIP2

PSTPIP2 binds to F-actin. May be involved in regulation of the actin cytoskeleton

Alternate Names

MAYP, MGC34175, PEST phosphatase-interacting protein 2, proline-serine-threonine phosphatase interacting protein 2, proline-serine-threonine phosphatase-interacting protein 2

Gene Symbol

PSTPIP2

Additional PSTPIP2 Products

Product Documents for PSTPIP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSTPIP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSTPIP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSTPIP2 Antibody - BSA Free and earn rewards!

Have you used PSTPIP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...