PYHIN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79436

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human PYHIN1The immunogen for this antibody is PYHIN1. Peptide sequence KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PYHIN1 Antibody - BSA Free

Western Blot: PYHIN1 Antibody [NBP1-79436]

Western Blot: PYHIN1 Antibody [NBP1-79436]

Western Blot: PYHIN1 Antibody [NBP1-79436] - 721_B cell lysate, concentration 0.2-1 ug/ml.
PYHIN1 Antibody - BSA Free

Western Blot: PYHIN1 Antibody - BSA Free [NBP1-79436] -

Silencing NKD2 induces EMT in CAL‐27 cells with overexpressed or silenced IFIX. (A) qRT‐PCR analysis quantifying NKD2 expression in CAL‐27 cells with stable expression of shRNA molecules. NKD2 expression levels in CAL‐27 cells with various treatments, including control, overexpressed IFIX (OE‐IFIX) and silenced IFIX (shIFIX), are shown. (B) Western blot analysis of NKD2 and IFIX protein levels in CAL‐27 cells with different treatments: vector control, OE‐IFIX, NC + NC, sh‐NKD2 and OE‐IFIX + sh‐NKD2. (C) Quantification of IFIX protein levels from Western blot analysis. (D) Quantification of NKD2 protein levels from Western blot analysis. (E) Western blot analysis of EMT markers (E‐cadherin, N‐cadherin, Snail and vimentin) in response to IFIX silencing by siRNA molecules in CAL‐27 cells with different treatments. (F‐I) Quantification of E‐cadherin, N‐cadherin, vimentin and Snail protein levels from Western blot analysis. Vector: OE‐IFIX CAL‐27‐vector cells; OE‐IFIX: overexpressed IFIX‐CAL‐27 cells; sh‐NKD2: Sh‐NKD2‐CAL‐27 cells; NC + NC: OE‐IFIX‐CAL‐27‐vector + sh‐NKD2 CAL‐27‐vector cells; OE‐IFIX + sh‐NKD2: OE‐IFIX + sh‐NKD2‐CAL‐27 cells. Error bars indicate mean +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39833105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PYHIN1 Antibody - BSA Free

Western Blot: PYHIN1 Antibody - BSA Free [NBP1-79436] -

Effects of NKD2 and IFIX on tumour growth and EMT in vivo. (A) Tumour growth curves of SCC‐25 cells with stable expression of sh‐NKD2, OE‐IFIX, OE‐IFIX + sh‐NKD2 or NC + NC grafted into nude mice (n = 4). Tumour volume was measured over time. Error bars indicate mean +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. (B) Images of tumours excised from nude mice at the end of the experiment. (C) Immunohistochemistry (IHC) analysis of EMT markers (E‐cadherin, N‐cadherin, vimentin and Snail) and NKD2 expression in tumour tissues from NC + NC, sh‐NKD2, OE‐IFIX and OE‐IFIX + sh‐NKD2 groups. Images captured at 20× magnification. (D) Western blot analysis of IFIX and NKD2 protein levels in tumour tissues, with GAPDH as a loading control. (E) Quantification of tumour weights from excised tumours. Error bars indicate mean +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. (F) Quantification of relative protein levels of IFIX and NKD2 from Western blot analysis. Error bars indicate mean +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39833105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PYHIN1 Antibody - BSA Free

Western Blot: PYHIN1 Antibody - BSA Free [NBP1-79436] -

Validation of knockdown and overexpression of IFIX in CAL‐27 and SCC‐25 cells. (A,B) qRT‐PCR analysis results showing relative IFIX mRNA expression levels in CAL‐27 and SCC‐25 cell lines. (C–F) Western blot analysis and its quantification showing relative IFIX protein expression levels in CAL‐27 and SCC‐25 cells stably expressing shRNA molecules. Each qRT‐PCR and Western blot experiment was repeated three times, and data are presented as mean +/- standard error (SE), ****p < 0.0001**p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39833105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PYHIN1 Antibody - BSA Free

Western Blot: PYHIN1 Antibody - BSA Free [NBP1-79436] -

Validation of knockdown and overexpression of IFIX in CAL‐27 and SCC‐25 cells. (A,B) qRT‐PCR analysis results showing relative IFIX mRNA expression levels in CAL‐27 and SCC‐25 cell lines. (C–F) Western blot analysis and its quantification showing relative IFIX protein expression levels in CAL‐27 and SCC‐25 cells stably expressing shRNA molecules. Each qRT‐PCR and Western blot experiment was repeated three times, and data are presented as mean +/- standard error (SE), ****p < 0.0001**p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39833105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PYHIN1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PYHIN1

PYHIN1 belongs to the HIN200 family of interferon-inducible proteins that share a 200-amino acid signature motif attheir C-terminal ends. HIN200 proteins are primarily nuclear and are involved in transcriptional regulation of genesimportant for cell cycle control, differentiation, and apoptosis (Ding et al., 2006 (PubMed 16479015)).(supplied byOMIM)

Alternate Names

IFIXMGC23885, Interferon-inducible protein X, pyrin and HIN domain family, member 1, pyrin and HIN domain-containing protein 1, RP11-520H16.1

Gene Symbol

PYHIN1

Additional PYHIN1 Products

Product Documents for PYHIN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PYHIN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PYHIN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PYHIN1 Antibody - BSA Free and earn rewards!

Have you used PYHIN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...