QTRT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53056

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to QTRT1(queuine tRNA-ribosyltransferase 1 (tRNA-guanine transglycosylase)) The peptide sequence was selected from the middle region of QTRT1. Peptide sequence KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for QTRT1 Antibody - BSA Free

Western Blot: QTRT1 Antibody [NBP1-53056]

Western Blot: QTRT1 Antibody [NBP1-53056]

Western Blot: QTRT1 Antibody [NBP1-53056] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for QTRT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: QTRT1

tRNA-guanine transglycosylase (TGT; EC 2.4.2.29) synthesizes queuosine (Q), which is found in tRNAs that recognize NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kD. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60-kD subunit (USP14; MIM 607274) and a 43-kD catalytic subunit (QTRT1). tRNA-guanine transglycosylase (TGT; EC 2.4.2.29) synthesizes queuosine (Q), which is found in tRNAs that recognize NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kD. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60-kD subunit (USP14; MIM 607274) and a 43-kD catalytic subunit (QTRT1) (Deshpande and Katze, 2001 [PubMed 11255023]).[supplied by OMIM].

Alternate Names

EC 2.4.2.29, Guanine insertion enzyme, queuine tRNA-ribosyltransferase, queuine tRNA-ribosyltransferase 1, TGTFP3235, TGUT, tRNA-guanine transglycosylase

Gene Symbol

QTRT1

UniProt

Additional QTRT1 Products

Product Documents for QTRT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for QTRT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for QTRT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review QTRT1 Antibody - BSA Free and earn rewards!

Have you used QTRT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for QTRT1 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We are interested in using an anti-QTRT1 antibody in Amoeba model. This sequence shares a 60% homology with the peptide which was used as an Immunogen of NBP1-53056.

    A:

    Normally, we like to see 80% homology or better for cross reactive species. However, it is definitely possible that this antibody may recognize the amoeba protein as some sections of the immunogen are conserved in the amoeba protein. Since this species has not been tested and the homology is less than 90%, we unfortunately cannot guarantee cross reactivity. We can offer our Innovator's Reward program, if your customer is still interested in trying this item. The program works by purchasing the item as normal, having your customer try the antibody and report their results as a review (positive or negative results). The review can be submitted online or by email to Innovators Reward. Once the review is received, we will provide you a credit for the purchase price of the antibody to provide to your customer for a future purchase. Details for this program can be found here: Innovators Reward

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...