RAB14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85571

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAB14 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB14. Peptide sequence: LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAB14 Antibody - BSA Free

Western Blot: RAB14 Antibody [NBP2-85571]

Western Blot: RAB14 Antibody [NBP2-85571]

Western Blot: RAB14 Antibody [NBP2-85571] - Host: Rabbit. Target Name: RAB14. Sample Type: THP-1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for RAB14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB14

RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 (PubMed 15004230)).(supplied by OMIM)

Alternate Names

bA165P4.3 (member RAS oncogene family), F protein-binding protein 1, FBP, RAB-14, RAB14, member RAS oncogene family, ras-related protein Rab-14, small GTP binding protein RAB14

Gene Symbol

RAB14

Additional RAB14 Products

Product Documents for RAB14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB14 Antibody - BSA Free and earn rewards!

Have you used RAB14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies