Rab2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82323

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Rab2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rab2. Peptide sequence: NTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGGC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Rab2 Antibody - BSA Free

Western Blot: Rab2 Antibody [NBP2-82323]

Western Blot: Rab2 Antibody [NBP2-82323]

Western Blot: Rab2 Antibody [NBP2-82323] - RAB2A antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.
Western Blot: Rab2 Antibody [NBP2-82323]

Western Blot: Rab2 Antibody [NBP2-82323]

Western Blot: Rab2 Antibody [NBP2-82323] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)3. Human Cervical Cancer Cell transfected with mouse Rab2A-GFP (15ug)Primary Dilution: 1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution: 1:40,000Ima

Applications for Rab2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rab2

Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rabs are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking. The mammalian RAB proteins show striking similarities to the S. cerevisiae YPT1 and SEC4 proteins, Ras-related GTP-binding proteins involved in the regulation of secretion.[supplied by OMIM]

Alternate Names

RAB2A, member RAS oncogene family, RAB2RAB2, member RAS oncogene family, ras-related protein Rab-2A, small GTP binding protein RAB2A

Gene Symbol

RAB2A

Additional Rab2 Products

Product Documents for Rab2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Rab2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rab2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rab2 Antibody - BSA Free and earn rewards!

Have you used Rab2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies