Rab3D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85577

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Rab3D Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Rab3D. Peptide sequence: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Rab3D Antibody - BSA Free

Western Blot: Rab3D Antibody [NBP2-85577]

Western Blot: Rab3D Antibody [NBP2-85577]

Western Blot: Rab3D Antibody [NBP2-85577] - WB Suggested Anti-RAB3D Antibody Titration: 2.5ug/ml. Positive Control: Transfected 293T
Western Blot: Rab3D Antibody [NBP2-85577]

Western Blot: Rab3D Antibody [NBP2-85577]

Western Blot: Rab3D Antibody [NBP2-85577] - WB Suggested Anti-RAB3D Antibody. Positive Control: Lane 1: BCAM0379 protein from B cenocepacia. Primary Antibody Dilution : 1:5000. Secondary Antibody : Anti-rabbit-HRP. Secondry Antibody Dilution : 1:5000. Submitted by: Katie Nurse

Applications for Rab3D Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rab3D

Protein transport. Probably involved in regulated exocytosis

Alternate Names

D2-2, GOVras-related protein Rab-3D, RAB16glioblastoma overexpressed, RAB3D, member RAS oncogene family, RAD3DRab3D upregulated with myeloid differentiation

Gene Symbol

RAB3D

Additional Rab3D Products

Product Documents for Rab3D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Rab3D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rab3D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rab3D Antibody - BSA Free and earn rewards!

Have you used Rab3D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies