RAB3GAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85578

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAB3GAP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB3GAP1. Peptide sequence: VLQDWQQYFWPQQPPDIDALVGGEVGGLEFGKLPFGACEDPISELHLATT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAB3GAP1 Antibody - BSA Free

Western Blot: RAB3GAP1 Antibody [NBP2-85578]

Western Blot: RAB3GAP1 Antibody [NBP2-85578]

Western Blot: RAB3GAP1 Antibody [NBP2-85578] - Host: Rabbit. Target Name: RAB3GAP1. Sample Tissue: Human NCI-H226 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for RAB3GAP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB3GAP1

Members of the RAB3 protein family (see RAB3A; MIM 179490) are implicated in regulated exocytosis of neurotransmitters and hormones. RAB3GAP, which is involved in regulation of RAB3 activity, is a heterodimeric complex consisting a 130-kD catalytic subunit and a 150-kD noncatalytic subunit (MIM 609275). RAB3GAP specifically converts active RAB3-GTP to the inactive form RAB3-GDP (Aligianis et al., 2005 [PubMed 15696165]).[supplied by OMIM]

Alternate Names

KIAA0066P130, RAB3 GTPase activating protein subunit 1 (catalytic), RAB3 GTPase-activating protein 130 kDa subunit, rab3 GTPase-activating protein catalytic subunit, Rab3-GAP, Rab3-GAP p130, RAB3GAPDKFZp434A012, WARBM1RAB3GAP130

Gene Symbol

RAB3GAP1

Additional RAB3GAP1 Products

Product Documents for RAB3GAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB3GAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB3GAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB3GAP1 Antibody - BSA Free and earn rewards!

Have you used RAB3GAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies