RAB8B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69095

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAB8B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAB8B Antibody - BSA Free

Western Blot: RAB8B Antibody [NBP1-69095]

Western Blot: RAB8B Antibody [NBP1-69095]

Western Blot: RAB8B Antibody [NBP1-69095] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%
Western Blot: RAB8B Antibody [NBP1-69095]

Western Blot: RAB8B Antibody [NBP1-69095]

Western Blot: RAB8B Antibody [NBP1-69095] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP (15ug) Primary Dilution: 1 : 1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1 : 40,000.

Applications for RAB8B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB8B

RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).

Alternate Names

FLJ38125, RAB-8b protein, RAB8B, member RAS oncogene family, ras-related protein Rab-8B

Gene Symbol

RAB8B

Additional RAB8B Products

Product Documents for RAB8B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAB8B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB8B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB8B Antibody - BSA Free and earn rewards!

Have you used RAB8B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies