RANBP9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85593

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Human RANB9. Peptide sequence: FTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RANBP9 Antibody - BSA Free

Western Blot: RANBP9 Antibody [NBP2-85593]

Western Blot: RANBP9 Antibody [NBP2-85593]

Western Blot: RANBP9 Antibody [NBP2-85593] - Host: Rabbit. Target Name: RANB9. Sample Type: MCF7 Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for RANBP9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RANBP9

Just as heat shock proteins function as chaperones for exposed hydrophobic patches, importins act as chaperones for exposed basic domains, and it is suggested that this represents a major and general cellular function of importins (1). RanBP9, a novel interacting protein, was localized within the centrosome throughout the cell cycle. Overexpression of RanBP9 produced multiple spots which were colocalized with gamma-tubulin and acted as ectopic microtubule nucleation sites, resulting in a reorganization of microtubule network (2). It has been shown that RanBP9 can induce GTP-Ras association and Erk phosphorylation and elevate serum response element-luciferase (SRE-LUC) expression, indicating that RanBP9 can activate the Ras-Erk-SRE pathway. Also RanBP9 stimulates Ras activation by recruiting Sos (3).

Alternate Names

BPM90, BPM-L, RAN binding protein 9, Ran Binding Protein in the Microtubule organizing center, ran binding protein, centrosomal, ran-binding protein 9, Ran-binding protein M, RanBP7, RanBP9, RanBPM, RANBPMnovel centrosomal protein RanBPM

Gene Symbol

RANBP9

Additional RANBP9 Products

Product Documents for RANBP9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RANBP9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RANBP9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RANBP9 Antibody - BSA Free and earn rewards!

Have you used RANBP9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...