RAP1GDS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69099

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RAP1GDS1 (RAP1, GTP-GDP dissociation stimulator 1) The peptide sequence was selected from the middle region of RAP1GDS1. Peptide sequence LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAP1GDS1 Antibody - BSA Free

Western Blot: RAP1GDS1 Antibody [NBP1-69099]

Western Blot: RAP1GDS1 Antibody [NBP1-69099]

Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: RAP1GDS1 Antibody [NBP1-69099]

Western Blot: RAP1GDS1 Antibody [NBP1-69099]

Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human lacenta Lysate 1ug/ml Gel Concentration 12%
Western Blot: RAP1GDS1 Antibody [NBP1-69099]

Western Blot: RAP1GDS1 Antibody [NBP1-69099]

Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: RAP1GDS1 Antibody [NBP1-69099]

Western Blot: RAP1GDS1 Antibody [NBP1-69099]

Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Jurkat, Antibody Dilution: 1.0 ug/ml RAP1GDS1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Applications for RAP1GDS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAP1GDS1

The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 [PubMed 8262526]).

Alternate Names

Exchange factor smgGDS, GDS1, MGC118859, MGC118861, rap1 GTPase-GDP dissociation stimulator 1, RAP1, GTP-GDP dissociation stimulator 1, SMG GDS protein, SMG P21 stimulatory GDP/GTP exchange protein, SmgGDS

Gene Symbol

RAP1GDS1

Additional RAP1GDS1 Products

Product Documents for RAP1GDS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAP1GDS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAP1GDS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAP1GDS1 Antibody - BSA Free and earn rewards!

Have you used RAP1GDS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...