RASGRF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85604

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASGRF1. Peptide sequence: EVSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RASGRF1 Antibody - BSA Free

Western Blot: RASGRF1 Antibody [NBP2-85604]

Western Blot: RASGRF1 Antibody [NBP2-85604]

Western Blot: RASGRF1 Antibody [NBP2-85604] - Host: Rabbit. Target Name: RASGRF1. Sample Type: 786-0 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for RASGRF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RASGRF1

RASGRF1 is a critical step in signal transduction responses to stimulation of cell surface receptors by their ligands involves the accumulation of Ras proteins in their active GTP-bound state. To reach their active GTP-bound state, Ras proteins must first release bound GDP, a rate limiting step mediated by a guanine nucleotide releasing factor (GRF). The mammalian Ras p21 GRF protein has been designated Ras-GRF1 p140. Ras-GRF1 accelerates release of GDP from H- and N-Ras p21 protein in vitro, but not from the related Ral A or Cdc42Hs GTP-binding proteins. Of interest, a region mapping within the amino terminal domain of Ras-GRF1 is similar to both the human breakpoint cluster protein, Bcr, and the Dbl proto-oncogene product, a guanine nucleotide-releasing factor for Cdc42Hs. Ras-GRF2 p135 has also been identified. Ras-GRF2 p135 is highly homologous to Ras-GRF1 p140 except in the region between the REM and CDC25 domains and appears to function similarly to Ras-GRF1 p140.

Alternate Names

CDC25guanine nucleotide exchange factor, CDC25L, GNRPguanine nucleotide-releasing factor 1, GRF1, GRF55, guanine nucleotide-releasing factor, 55 kD, Guanine nucleotide-releasing protein, H-GRF55, PP13187, Ras protein-specific guanine nucleotide-releasing factor 1, Ras-GRF1, ras-specific guanine nucleotide-releasing factor 1, Ras-specific guanine nucleotide-releasing factor, CDC25 homolog, Ras-specific nucleotide exchange factor CDC25

Gene Symbol

RASGRF1

Additional RASGRF1 Products

Product Documents for RASGRF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RASGRF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RASGRF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RASGRF1 Antibody - BSA Free and earn rewards!

Have you used RASGRF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...