RBP7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85613

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RBP7 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBP7. Peptide sequence: TIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RBP7 Antibody - BSA Free

Western Blot: RBP7 Antibody [NBP2-85613]

Western Blot: RBP7 Antibody [NBP2-85613]

Western Blot: RBP7 Antibody [NBP2-85613] - Host: Rabbit. Target Name: RBP7. Sample Tissue: Stomach Tumor lysates. Antibody Dilution: 1ug/ml

Applications for RBP7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBP7

Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM]

Alternate Names

Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV, CRABP4, CRABP-IV, CRBP4, CRBPIV, MGC70641, putative cellular retinol-binding protein CRBP IV, retinoid binding protein 7, retinoid-binding protein 7, retinol binding protein 7, cellular

Gene Symbol

RBP7

Additional RBP7 Products

Product Documents for RBP7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RBP7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBP7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBP7 Antibody - BSA Free and earn rewards!

Have you used RBP7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies