REPIN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85620

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human REPIN1. Peptide sequence: GNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for REPIN1 Antibody - BSA Free

Western Blot: REPIN1 Antibody [NBP2-85620]

Western Blot: REPIN1 Antibody [NBP2-85620]

Western Blot: REPIN1 Antibody [NBP2-85620] - WB Suggested Anti-REPIN1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart

Applications for REPIN1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REPIN1

REPIN1, also known as Replication initiator 1, is a 64kDa 567 amino acid protein that can be found in the nucleus. This gene is necessary for the process of initiating the chromosomal DNA replication. REPIN1 has been researched in relation to acrodermatitis enteropathica, enteropathica, acrodermatitis and immunodeficiency. REPIN1 has been linked to the synaptic transmission, cell proliferation, DNA replication, fatty acid transport and cell growth pathways where it interacts with GMNN, HDAC3, HDAC1, HDAC2 and GATA3.

Alternate Names

60 kDa origin-specific DNA-binding protein, 60 kDa replication initiation region protein, ATT-binding protein, DHFR oribeta-binding protein RIP60, H_DJ0584D14.12, replication initiation region protein (60kD), replication initiator 1, RIP60AP4, Zfp464, Zinc finger protein 464, zinc finger protein 464 (RIP60), zinc finger protein AP4, zinc finger proten AP4, ZNF464

Gene Symbol

REPIN1

Additional REPIN1 Products

Product Documents for REPIN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for REPIN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for REPIN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review REPIN1 Antibody - BSA Free and earn rewards!

Have you used REPIN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...