Ribosome maturation protein SBDS Antibody (9V4J9)

Novus Biologicals | Catalog # NBP3-15306

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9V4J9 expressed in HEK293
View all Ribosome maturation protein SBDS Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 151-250 of human Ribosome maturation protein SBDS (NP_057122.2). KQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ribosome maturation protein SBDS Antibody (9V4J9)

Western Blot: Ribosome maturation protein SBDS Antibody (9V4J9) [NBP3-15306]

Western Blot: Ribosome maturation protein SBDS Antibody (9V4J9) [NBP3-15306]

Western Blot: Ribosome maturation protein SBDS Antibody (9V4J9) [NBP3-15306] - Western blot analysis of extracts of various cell lines, using Ribosome maturation protein SBDS antibody (NBP3-15306) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Applications for Ribosome maturation protein SBDS Antibody (9V4J9)

Application
Recommended Usage

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Ribosome maturation protein SBDS

The Shwachman Bodian-Diamond syndrome gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located. [provided by RefSeq, Jan 2017]

Alternate Names

FLJ10917, ribosome maturation protein SBDS, SDSCGI-97, Shwachman-Bodian-Diamond syndrome, Shwachman-Bodian-Diamond syndrome protein, SWDS

Gene Symbol

SBDS

Additional Ribosome maturation protein SBDS Products

Product Documents for Ribosome maturation protein SBDS Antibody (9V4J9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ribosome maturation protein SBDS Antibody (9V4J9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ribosome maturation protein SBDS Antibody (9V4J9)

There are currently no reviews for this product. Be the first to review Ribosome maturation protein SBDS Antibody (9V4J9) and earn rewards!

Have you used Ribosome maturation protein SBDS Antibody (9V4J9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies