RMND5A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94019

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all RMND5A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-270 of human RMND5A (NP_073617.1). ISLLMGGTTNQREALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RMND5A Antibody - Azide and BSA Free

Western Blot: RMND5A AntibodyAzide and BSA Free [NBP2-94019]

Western Blot: RMND5A AntibodyAzide and BSA Free [NBP2-94019]

Western Blot: RMND5A Antibody [NBP2-94019] - Analysis of extracts of various cell lines, using RMND5A at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for RMND5A Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RMND5A

RMND5A, also known as Protein RMD5 homolog A, consists of a 391 amino acid long isoform that is 44 kDa and a 98 amino acid short isoform that is 11 kDa, and it is involved in protein binding and required for meiotic nuclear division. Studies of RMND5A are being done on the following diseases and disorders: lissencephaly, malaria and ductus arteriosus. This protein has been known to have interactions with SHBG, SMAD9, C20orf11, GID8, POLR3H, YPEL4, RANBP9, MKLN1, KLHL2 and CCT3 proteins.

Alternate Names

C-terminal to LisH motif, 44 kDa, CTLH, FLJ12753, FLJ13910, FLJ21795, MGC78451, p44CTLH, protein RMD5 homolog A, required for meiotic nuclear division 5 homolog A (S. cerevisiae), RMD5

Gene Symbol

RMND5A

Additional RMND5A Products

Product Documents for RMND5A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RMND5A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for RMND5A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RMND5A Antibody - Azide and BSA Free and earn rewards!

Have you used RMND5A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies