RNF7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88166

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RNF7. Peptide sequence: ALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDAC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RNF7 Antibody - BSA Free

Western Blot: RNF7 Antibody [NBP2-88166]

Western Blot: RNF7 Antibody [NBP2-88166]

Western Blot: RNF7 Antibody [NBP2-88166] - Host: Rabbit. Target Name: RBX2. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for RNF7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNF7

RNF7 is encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Alternate Names

CKBBP1zinc RING finger protein SAG, CKII beta-binding protein 1, Rbx2, Regulator of cullins 2, ring finger protein 7rbx2, ROC2RING-box protein 2, SAGsensitive to apoptosis, zinc RING finger protein SAG, regulator of cullins 2, Sensitive to apoptosis gene protein

Gene Symbol

RNF7

Additional RNF7 Products

Product Documents for RNF7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNF7 Antibody - BSA Free and earn rewards!

Have you used RNF7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...