RNGTT Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09262

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RNGTT Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of RNGTT (NP_036014). Peptide sequence DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RNGTT Antibody - BSA Free

Western Blot: RNGTT Antibody [NBP3-09262]

Western Blot: RNGTT Antibody [NBP3-09262]

Western Blot: RNGTT Antibody [NBP3-09262] - Western blot analysis of RNGTT in Mouse Heart as a positive control. Antibody dilution at 1.0 ug/ml

Applications for RNGTT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNGTT

Bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part. Catalyzes the first two steps of cap formation: by removing the gamma-phosphate from the 5'-triphosphate end of nascent mRNA to yield a diphosphate end, and by transferring the gmp moiety of GTP to the 5'-diphosphate terminus

Alternate Names

CAP1AmRNA-capping enzyme, hCAP, HCE1DKFZp686J2031, HCEHCAP1, RNA guanylyltransferase and 5'-phosphatase

Gene Symbol

RNGTT

Additional RNGTT Products

Product Documents for RNGTT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNGTT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNGTT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNGTT Antibody - BSA Free and earn rewards!

Have you used RNGTT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies