RNPC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57138

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RNPC3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RNPC3(RNA-binding region (RNP1, RRM) containing 3) The peptide sequence was selected from the middle region of RNPC3. Peptide sequence LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RNPC3 Antibody - BSA Free

Western Blot: RNPC3 Antibody [NBP1-57138]

Western Blot: RNPC3 Antibody [NBP1-57138]

Western Blot: RNPC3 Antibody [NBP1-57138] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Applications for RNPC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNPC3

RNPC3 is an RNA-binding protein involved in pre-mRNA splicing. RNPC3 participates in pre-mRNA U12-dependent splicing. RNPC3 binds to the 3'-stem-loop of m7G-capped U12 snRNA.Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 65K protein that is a component of the U12-type spliceosome. This protein contains two RNA recognition motifs (RRMs), suggesting that it may contact one of the small nuclear RNAs of the minor spliceosome.

Alternate Names

FLJ20008, FLJ25070, KIAA183, KIAA1839, RBM40U11/U12 snRNP 65 kDa protein, RNA recognition protein, RNA-binding motif protein 40, RNA-binding protein 40, RNA-binding region (RNP1, RRM) containing 3, RNA-binding region-containing protein 3, RNP, U11/U12 small nuclear ribonucleoprotein 65 kDa protein, U11/U12 snRNP 65K, U11/U12-65K

Gene Symbol

RNPC3

UniProt

Q96LT9 (Human)

Additional RNPC3 Products

Product Documents for RNPC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RNPC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNPC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNPC3 Antibody - BSA Free and earn rewards!

Have you used RNPC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies