RPGRIP1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88181

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RPGRIP1L Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPGRIP1L. Peptide sequence: HARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RPGRIP1L Antibody - BSA Free

Western Blot: RPGRIP1L Antibody [NBP2-88181]

Western Blot: RPGRIP1L Antibody [NBP2-88181]

Western Blot: RPGRIP1L Antibody [NBP2-88181] - Host: Rabbit. Target Name: FTM. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for RPGRIP1L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPGRIP1L

RPGRIP1L is encoded by this gene can localize to the basal body-centrosome complex or to primary cilia and centrosomes in ciliated cells. The encoded protein has been found to interact with nephrocystin-4. Defects in this gene are a cause of Joubert syndrome type 7 (JBTS7) and Meckel syndrome type 5 (MKS5). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

CORS3, FTMDKFZp686C0668, JBTS7fantom homolog, KIAA1005RPGRIP1-like protein, MKS5nephrocystin 8, NPHP8, protein fantom, RPGR-interacting protein 1-like protein, RPGRIP1-like

Gene Symbol

RPGRIP1L

Additional RPGRIP1L Products

Product Documents for RPGRIP1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPGRIP1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPGRIP1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPGRIP1L Antibody - BSA Free and earn rewards!

Have you used RPGRIP1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies