RPL13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88183

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RPL13. Peptide sequence: KGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RPL13 Antibody - BSA Free

Western Blot: RPL13 Antibody [NBP2-88183]

Western Blot: RPL13 Antibody [NBP2-88183]

Western Blot: RPL13 Antibody [NBP2-88183] - WB Suggested Anti-RPL13 Antibody Titration: 2.5ug/ml. Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that RPL13 is expressed in HepG2

Applications for RPL13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL13

RPL13, also known as 60S ribosomal protein L13, is a 24kDa 211 amino acid protein with a shorter 19kDA 164 isoform produced by alternative splicing. RPL13 belongs to the L13E family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on RPL13 in relation to Smith-Magenis syndrome, Treacher Collins syndrome, breast carcinoma, carcinoma, skin atrophy, prostate cancer, prostatitis, schizophrenia and malaria. RPL13 has been linked to the reverse transcription, ribosome assembly, cell division, DNA protection and pigmentation pathways where it interacts with RPL4, RPL8, RPS3, SMN1 and RPL12.

Alternate Names

BBC1FLJ27454, Breast basic conserved protein 1, D16S444E, FLJ27453, MGC117342, MGC71373,60S ribosomal protein L13, OK/SW-cl.46, ribosomal protein L13

Gene Symbol

RPL13

Additional RPL13 Products

Product Documents for RPL13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL13 Antibody - BSA Free and earn rewards!

Have you used RPL13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...