RPL22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86783

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RPL22 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of RPL22. Peptide sequence: TSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RPL22 Antibody - BSA Free

Western Blot: RPL22 Antibody [NBP2-86783]

Western Blot: RPL22 Antibody [NBP2-86783]

Western Blot: RPL22 Antibody [NBP2-86783] - WB Suggested Anti-RPL22 Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta

Applications for RPL22 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL22

RPL22, also known as 60S ribosomal protein L22, is a 15kDa 128 amino acid protein. The primary function of RPL22 is to encode a cytoplasmic ribosomal protein. Current research is being conducted on RPL22 in relation to hepatitis, carcinoma, malaria, leukemia, hepatitis c, pneumonia and lung carcinoma. RPL22 has been linked to the virulence, methylation, contact inhibition, pathogenesis and cell growth pathways where it interacts with SHC1, UBA5, CSE1L, PRKAG1 and MAP3K14.

Alternate Names

EAPHBP15, EBER-associated protein, Epstein-Barr virus small RNA-associated protein, Epstein-Barr-encoded RNA-associated protein, HBP15/L22, heparin-binding protein 15, Heparin-binding protein HBp15, ribosomal protein L22,60S ribosomal protein L22

Gene Symbol

RPL22

Additional RPL22 Products

Product Documents for RPL22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL22 Antibody - BSA Free and earn rewards!

Have you used RPL22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies